PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100010740172
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 441aa    MW: 49517 Da    PI: 6.0691
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100010740172genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like106.12e-33241295155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+r+rWtpeLHe+Fveav++LGGse+AtPk +l+lmk +gLt++hvkSHLQkYR+
  Ote100010740172|100010740172 241 KQRMRWTPELHEAFVEAVNKLGGSERATPKGVLKLMKAEGLTIYHVKSHLQKYRT 295
                                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.313238298IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-30239297IPR009057Homeodomain-like
SuperFamilySSF466892.69E-17239295IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-24241295IPR006447Myb domain, plants
PfamPF002492.6E-10243294IPR001005SANT/Myb domain
PfamPF143794.1E-24326372IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 441 aa     Download sequence    Send to blast
VTGHKLKLLG SYHRRWELNQ LYLFKDRGNR PNFSDSHQVS LGRVFNQRLP ATLPSNSGVV  60
GHIYSSSSGF SSDLHFSSVQ QQEKHPKQSP FISQSTNSKS FDLVQHSTDS GYLQSTASSH  120
SNKDNMNSWC TDALPEFFDF QNSQLDVGNS VAVVAPSEDL CKPSEWQDWA DNLITEDDAL  180
TSDWNDILTD ANTLDPDLKL MSKPSTCISM QPQVAQQLPA TYRETISAFG QSSSTNTAPA  240
KQRMRWTPEL HEAFVEAVNK LGGSERATPK GVLKLMKAEG LTIYHVKSHL QKYRTARYKP  300
ESTEESSERK TTSIDQLSSL DLKTGIEITE ALRLQMEVQK RLHEQLEIQR NLQLRIEEQG  360
RCLQMMFEKQ YKAGPEWLKG GSSTAENALK ELTDIDQKPP PKDNSVAEAD KSNTEGDSAE  420
VLENSSAKVE EQPLKRARVH D
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011083055.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011083056.10.0PREDICTED: protein PHR1-LIKE 1-like
RefseqXP_011083057.10.0PREDICTED: protein PHR1-LIKE 1-like
TrEMBLA0A022S2541e-180A0A022S254_ERYGU; Uncharacterized protein
STRINGVIT_07s0005g04120.t011e-151(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27532349